Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin-Like Peptide (human)

Galanin-Like Peptide (human) is a 60 amino acid neuropeptide. Galanin-Like Peptide (human) plays an important role in the regulation of feeding, body weight and energy metabolism.

Product Specifications

Purity

≥95%

Molecular Weight

6500.28

Notes

For research use only.

AA Sequence

APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Solute Carrier Family 1, Member 5 (SLC1A5) ELISA Kit
RD-SLC1A5-Hu-01 96 Tests

Human Solute Carrier Family 1, Member 5 (SLC1A5) ELISA Kit

Sign In for Pricing
View Details
Human Solute Carrier Family 1, Member 5 (SLC1A5) ELISA Kit
RD-SLC1A5-Hu-02 48 Tests

Human Solute Carrier Family 1, Member 5 (SLC1A5) ELISA Kit

Sign In for Pricing
View Details
MON1A Rabbit Polyclonal Antibody
TA378600 100 µL

MON1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker) (rGPC3/863), CF568 conjugate, 0.1mg/mL
BNC681846-500 1x 500 µL

Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker) (rGPC3/863), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VX 809
TRC-V900700-50MG 50 mg

VX 809

Sign In for Pricing
View Details
Human ZBTB12 activation kit by CRISPRa
GA116628 1 Kit

Human ZBTB12 activation kit by CRISPRa

Sign In for Pricing
View Details