Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin-Like Peptide (human)

Galanin-Like Peptide (human) is a 60 amino acid neuropeptide. Galanin-Like Peptide (human) plays an important role in the regulation of feeding, body weight and energy metabolism.

Product Specifications

Purity

≥95%

Molecular Weight

6500.28

Notes

For research use only.

AA Sequence

APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INSL3 (NM_005543) Human Recombinant Protein
TP309944 20 µg

INSL3 (NM_005543) Human Recombinant Protein

Sign In for Pricing
View Details
Human PELP1 activation kit by CRISPRa
GA108983 1 Kit

Human PELP1 activation kit by CRISPRa

Sign In for Pricing
View Details
BMPR2 (NM_001204) Human Recombinant Protein
TP720272XL 1 mg

BMPR2 (NM_001204) Human Recombinant Protein

Sign In for Pricing
View Details
beta-Cyclodextrin
TRC-C987830-50G 50 g

beta-Cyclodextrin

Sign In for Pricing
View Details
NSMCE1 Human Gene Knockout Kit (CRISPR)
KN418073 1 Kit

NSMCE1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bosutinib N-Oxide
TRC-B676125-50MG 50 mg

Bosutinib N-Oxide

Sign In for Pricing
View Details