Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin-Like Peptide (rat)

Galanin-Like Peptide (rat) is a 60 amino acid neuropeptide. Galanin-Like Peptide (rat) plays an important role in the regulation of feeding, body weight and energy metabolism.

Product Specifications

Purity

≥95%

Molecular Weight

422.23

Notes

For research use only.

AA Sequence

APAHRGRGGWTLNSAGYLLGPVLHLSSKANQGRKTDSALEILDLWKAIDGLPYSRSPRMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adenosine Colorimetric Assay Kit
E-BC-K833-M 96 T (40 samples)

Adenosine Colorimetric Assay Kit

Sign In for Pricing
View Details
HAUS4 (NM_001166270) Human Over-expression Lysate
LC432875 20 µg

HAUS4 (NM_001166270) Human Over-expression Lysate

Sign In for Pricing
View Details
OR2T29 (NM_001004694) Human Over-expression Lysate
LY423882 100 µg

OR2T29 (NM_001004694) Human Over-expression Lysate

Sign In for Pricing
View Details
Floor Type Low Speed Refrigerated Centrifuge BCFLR-201
BCFLR-201 1 Unit

Floor Type Low Speed Refrigerated Centrifuge BCFLR-201

Sign In for Pricing
View Details
FOXD4L2 (FOXD4L4) Human Gene Knockout Kit (CRISPR)
KN419923 1 Kit

FOXD4L2 (FOXD4L4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
POTEG Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10E12]
TA808187AM 100 µL

POTEG Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10E12]

Sign In for Pricing
View Details