Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin-Like Peptide (rat)

Galanin-Like Peptide (rat) is a 60 amino acid neuropeptide. Galanin-Like Peptide (rat) plays an important role in the regulation of feeding, body weight and energy metabolism.

Product Specifications

Purity

≥95%

Molecular Weight

422.23

Notes

For research use only.

AA Sequence

APAHRGRGGWTLNSAGYLLGPVLHLSSKANQGRKTDSALEILDLWKAIDGLPYSRSPRMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Uterus
CS805654 5x 5 µm

Tissue FFPE Sections, Uterus

Sign In for Pricing
View Details
C1ORF151 (MINOS1) (NM_001032363) Human Recombinant Protein
TP312930L 1 mg

C1ORF151 (MINOS1) (NM_001032363) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human PF4 protein (GST tag)
PDEH100773-01 20 µg

Recombinant Human PF4 protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human PF4 protein (GST tag)
PDEH100773-02 100 µg

Recombinant Human PF4 protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human PF4 protein (GST tag)
PDEH100773-03 500 µg

Recombinant Human PF4 protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human PF4 protein (GST tag)
PDEH100773-04 1 mg

Recombinant Human PF4 protein (GST tag)

Sign In for Pricing
View Details