Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin-Like Peptide (rat)

Galanin-Like Peptide (rat) is a 60 amino acid neuropeptide. Galanin-Like Peptide (rat) plays an important role in the regulation of feeding, body weight and energy metabolism.

Product Specifications

Purity

≥95%

Molecular Weight

422.23

Notes

For research use only.

AA Sequence

APAHRGRGGWTLNSAGYLLGPVLHLSSKANQGRKTDSALEILDLWKAIDGLPYSRSPRMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse C2cd6 activation kit by CRISPRa
GA209507 1 Kit

Mouse C2cd6 activation kit by CRISPRa

Sign In for Pricing
View Details
Nephrin (NPHS1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI12D7]
TA813415BM 100 µL

Nephrin (NPHS1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI12D7]

Sign In for Pricing
View Details
CMTM6 Antibody
KC-316-01 50 μL

CMTM6 Antibody

Sign In for Pricing
View Details
CMTM6 Antibody
KC-316-02 100 µL

CMTM6 Antibody

Sign In for Pricing
View Details
CMTM6 Antibody
KC-316-03 1 mL

CMTM6 Antibody

Sign In for Pricing
View Details
LCE3A Human Gene Knockout Kit (CRISPR)
KN222176RB 1 Kit

LCE3A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details