Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin-Like Peptide (rat)

Galanin-Like Peptide (rat) is a 60 amino acid neuropeptide. Galanin-Like Peptide (rat) plays an important role in the regulation of feeding, body weight and energy metabolism.

Product Specifications

Purity

≥95%

Molecular Weight

422.23

Notes

For research use only.

AA Sequence

APAHRGRGGWTLNSAGYLLGPVLHLSSKANQGRKTDSALEILDLWKAIDGLPYSRSPRMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD68 (KP1), CF555 conjugate, 0.1mg/mL
BNC550512-100 1x 100 µL

CD68 (KP1), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cystathionase (CTH) Human Gene Knockout Kit (CRISPR)
KN402195 1 Kit

Cystathionase (CTH) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tilorone Dihydrochloride
TRC-T440800-1G 1 g

Tilorone Dihydrochloride

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS711362 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
iNOS (NOS2) Rabbit Polyclonal Antibody
AP06181PU-N 100 µg

iNOS (NOS2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501148 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details