Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin-Like Peptide (rat)

Galanin-Like Peptide (rat) is a 60 amino acid neuropeptide. Galanin-Like Peptide (rat) plays an important role in the regulation of feeding, body weight and energy metabolism.

Product Specifications

Purity

≥95%

Molecular Weight

422.23

Notes

For research use only.

AA Sequence

APAHRGRGGWTLNSAGYLLGPVLHLSSKANQGRKTDSALEILDLWKAIDGLPYSRSPRMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Endometrium
CS702849 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
HSPC111 (NOP16) Human qPCR Primer Pair (BC032424)
HP223866 200 Reactions

HSPC111 (NOP16) Human qPCR Primer Pair (BC032424)

Sign In for Pricing
View Details
GALNS (NM_000512) Human Over-expression Lysate
LY424670 100 µg

GALNS (NM_000512) Human Over-expression Lysate

Sign In for Pricing
View Details
SnoN (SKIL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F6]
TA800171BM 100 µL

SnoN (SKIL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F6]

Sign In for Pricing
View Details
Hmgn2 (BC083085) Mouse Tagged ORF Clone
MG200241 10 µg

Hmgn2 (BC083085) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SULT1B1 (C-term) Rabbit Polyclonal Antibody
AP54103PU-N 400 µL

SULT1B1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details