Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cecropin B

Cecropin B has high level of antimicrobial activity and is considered as a valuable peptide antibiotic.

Product Specifications

Purity

≥95%

Solubility

Water: 66.67 mg/mL

Molecular Weight

3834.76

Notes

For research use only.

AA Sequence

KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Protein FAM55B (Fam55b)
orb2923527-01 20 µg

Recombinant Mouse Protein FAM55B (Fam55b)

Sign In for Pricing
View Details
Recombinant Mouse Protein FAM55B (Fam55b)
orb2923527-02 100 µg

Recombinant Mouse Protein FAM55B (Fam55b)

Sign In for Pricing
View Details
Fruit fly rig Rabbit Polyclonal Antibody (HRP)
orb2572474 200 µL

Fruit fly rig Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Human Endoglin/CD105 Protein (His Tag)
PKSH031831 50 µg

Recombinant Human Endoglin/CD105 Protein (His Tag)

Sign In for Pricing
View Details
HSPA5, ID (HSPA5, GRP78, 78kD glucose-regulated protein, Endoplasmic reticulum lumenal Ca (2+) -binding protein grp78, Heat shock 70kD protein 5, Immunoglobulin heavy chain-binding protein) (MaxLight 550) discontinued
036803-ML550 100 µL

HSPA5, ID (HSPA5, GRP78, 78kD glucose-regulated protein, Endoplasmic reticulum lumenal Ca (2+) -binding protein grp78, Heat shock 70kD protein 5, Immunoglobulin heavy chain-binding protein) (MaxLight 550) discontinued

Sign In for Pricing
View Details
HTR3B Antibody
DF10195-01 100 µL

HTR3B Antibody

Sign In for Pricing
View Details