Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cecropin B

Cecropin B has high level of antimicrobial activity and is considered as a valuable peptide antibiotic.

Product Specifications

Purity

≥95%

Solubility

Water: 66.67 mg/mL

Molecular Weight

3834.76

Notes

For research use only.

AA Sequence

KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Albumin
orb196499 1 mg

Human Albumin

Sign In for Pricing
View Details
HSPG (Heparan Sulfate Proteoglycan) Porcine ELISA Kit
E1397 96 Tests

HSPG (Heparan Sulfate Proteoglycan) Porcine ELISA Kit

Sign In for Pricing
View Details
PLCG 2 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1576750 100 µL

PLCG 2 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-18 (Il18)
CSB-YP011608MOe1-01 20 µg

Recombinant Mouse Interleukin-18 (Il18)

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-18 (Il18)
CSB-YP011608MOe1-02 100 µg

Recombinant Mouse Interleukin-18 (Il18)

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-18 (Il18)
CSB-YP011608MOe1-03 1 mg

Recombinant Mouse Interleukin-18 (Il18)

Sign In for Pricing
View Details