Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cecropin B

Cecropin B has high level of antimicrobial activity and is considered as a valuable peptide antibiotic.

Product Specifications

Purity

≥95%

Solubility

Water: 66.67 mg/mL

Molecular Weight

3834.76

Notes

For research use only.

AA Sequence

KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human Meckel syndrome, type 1 polyclonal Antibody
MBS712674-01 0.1 mL

Rabbit anti-human Meckel syndrome, type 1 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human Meckel syndrome, type 1 polyclonal Antibody
MBS712674-02 5x 0.1 mL

Rabbit anti-human Meckel syndrome, type 1 polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Kcnj11 shRNA (UAS) - Lentiviral mouse Kcnj11 shRNA (UAS, iRFP) plasmid
GTR15227248 1 Vial

Lentiviral mouse Kcnj11 shRNA (UAS) - Lentiviral mouse Kcnj11 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Ptpa Rat Pre-designed siRNA Set A
HY-RS25458 1 Set

Ptpa Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Laminin 5 Rabbit Polyclonal Antibody (BF488)
orb2398380 100 µL

Laminin 5 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
CAY10505
C08776-10mg 10 mg

CAY10505

Sign In for Pricing
View Details