Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM21, Human (HEK293, His)

CEA21/CEACAM21, a carcinoembryonic antigen (CEA) -related cell adhesion molecule, is expressed on granulocytes. CEACAM21 is also a biological candidate gene for schizophrenia and type I diabetes, with SNPs consistently associated with the disease. CEACAM21 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM21 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM21 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam21-protein-human-hek-293-his.html

Purity

98.0

Smiles

WLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYTLQVTYRNSQIEQASHHLRVYESVAQPSIQASSTTVTEKGSVVLTCHTNNTGTSFQWIFNNQRLQVTKRMKLSWFNHMLTIDPIRQEDAGEYQCEVSNPVSSNRSDPLKLTVKSDDNTLG

Molecular Formula

90273 (Gene_ID) Q3KPI0-1/AAI06728.1 (W35-G240) (Accession)

Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal DMRT1 Antibody (OTI1G10) [Allophycocyanin]
NBP2-70582APC 0.1 mL

Mouse Monoclonal DMRT1 Antibody (OTI1G10) [Allophycocyanin]

Sign In for Pricing
View Details
Mouse Anti-Mouse CD45.1/Ly-5.1-BIOT
MBS673522-01 0.5 mg

Mouse Anti-Mouse CD45.1/Ly-5.1-BIOT

Sign In for Pricing
View Details
Mouse Anti-Mouse CD45.1/Ly-5.1-BIOT
MBS673522-02 5x 0.5 mg

Mouse Anti-Mouse CD45.1/Ly-5.1-BIOT

Sign In for Pricing
View Details
Reagecon pH 4.60 Technical Colour Coded Buffer Solution at 25°C
TB4602 250 mL

Reagecon pH 4.60 Technical Colour Coded Buffer Solution at 25°C

Sign In for Pricing
View Details
Suppression Of Tumorigenicity 14 (ST14) Antibody
abx320124-01 20 µL

Suppression Of Tumorigenicity 14 (ST14) Antibody

Sign In for Pricing
View Details
Suppression Of Tumorigenicity 14 (ST14) Antibody
abx320124-02 50 µL

Suppression Of Tumorigenicity 14 (ST14) Antibody

Sign In for Pricing
View Details