What is the catalog number for Cecropin A?

The catalog number for Cecropin A is orb2692695.

What sizes are available for Cecropin A?

Cecropin A is available in the following size(s): 5 mg, 10 mg.

Cecropin A is available in 2 different pack sizes.

Cecropin A is currently made to order / not held in immediate stock. Contact us for lead time.

Cecropin A is a linear 37-residue antimicrobial polypeptide, with anticancer and anti-inflammatory activity.

≥95%

4003.87

For research use only.

KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2

More Discoveries

Browse additional items from our catalog

E19-4417 100 µg -100 µL

Sign In for Pricing

sc-422065-LAC 200 µL

Sign In for Pricing

MBS6401864-01 0.1 mL

Sign In for Pricing

MBS6401864-02 5x 0.1 mL

Sign In for Pricing

KN407307 1 Kit

Sign In for Pricing

MBS1583529-01 50 Tests

Sign In for Pricing