What is the catalog number for Cecropin A?

The catalog number for Cecropin A is orb2692695.

What sizes are available for Cecropin A?

Cecropin A is available in the following size(s): 5 mg, 10 mg.

Cecropin A is available in 2 different pack sizes.

Cecropin A is currently made to order / not held in immediate stock. Contact us for lead time.

Cecropin A is a linear 37-residue antimicrobial polypeptide, with anticancer and anti-inflammatory activity.

≥95%

4003.87

For research use only.

KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2

More Discoveries

Browse additional items from our catalog

S01-039 20 µg

Sign In for Pricing

MBS3845625-01 1 mg

Sign In for Pricing

MBS3845625-02 5 mg

Sign In for Pricing

MBS3845625-03 10 mg

Sign In for Pricing

MBS3845625-04 50 mg

Sign In for Pricing

CSB-PA005613-01 50 µg

Sign In for Pricing