CAP - 18, rabbit
CAP18 (rabbit) is a 37 amino acids antimicrobial peptide originally isolated from rabbit granulocytes. CAP18 (rabbit) has broad antimicrobial activity against both Gram-positive (IC50, 130-200 nM) and Gram-negative (IC50, 20-100 nM) bacteria. CAP18 (rabbit) has the potential for bacterial sepsis research.
Product Specifications
Purity
≥95%
Molecular Weight
4433.49
Notes
For research use only.
AA Sequence
GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
PD76627 500 mg
1- (5',6'-Dideoxy-6'-dimethylphosphono-2'-O- (2-methoxyethyl) -5-methyl-b-D-ribo-hex-5 (E) -enofuranosyl) uracil 3'-CE phosphoroamidite
Sign In for Pricing
View Details 021-65 500 µg
[Des-Phe1]-Orphanin FQ / [Des-Phe1]-Nociceptin (Human, Rat, Mouse, Ox)
Sign In for Pricing
View Details ![4-[2- (4-Oxo-2-sulfanyl-3,4-dihydroquinazolin-3-yl) ethyl]benzene-1-sulfonamide](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
BTA46563-01 250 mg
4-[2- (4-Oxo-2-sulfanyl-3,4-dihydroquinazolin-3-yl) ethyl]benzene-1-sulfonamide
Sign In for Pricing
View Details BTA46563-02 2.5 g
4-[2- (4-Oxo-2-sulfanyl-3,4-dihydroquinazolin-3-yl) ethyl]benzene-1-sulfonamide
Sign In for Pricing
View Details 
orb2902064-01 20 µg
Recombinant Human Golgi integral membrane protein 4 (GOLIM4)
Sign In for Pricing
View Details