CAP - 18, rabbit
CAP18 (rabbit) is a 37 amino acids antimicrobial peptide originally isolated from rabbit granulocytes. CAP18 (rabbit) has broad antimicrobial activity against both Gram-positive (IC50, 130-200 nM) and Gram-negative (IC50, 20-100 nM) bacteria. CAP18 (rabbit) has the potential for bacterial sepsis research.
Product Specifications
Purity
≥95%
Molecular Weight
4433.49
Notes
For research use only.
AA Sequence
GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
TL510608V 500 µL Each
Dmrta2 Mouse shRNA Lentiviral Particle (Locus ID 242620)
Sign In for Pricing
View Details