CAP - 18, rabbit
CAP18 (rabbit) is a 37 amino acids antimicrobial peptide originally isolated from rabbit granulocytes. CAP18 (rabbit) has broad antimicrobial activity against both Gram-positive (IC50, 130-200 nM) and Gram-negative (IC50, 20-100 nM) bacteria. CAP18 (rabbit) has the potential for bacterial sepsis research.
Product Specifications
Purity
≥95%
Molecular Weight
4433.49
Notes
For research use only.
AA Sequence
GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
K7319006 1.0 µg DNA
Snapc3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
Sign In for Pricing
View Details 
