Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCRAMP, mouse

MCRAMP (mouse) or mouse calethicidin-related antimicrobial peptide, is the sole murine cathelicidin and intestinal homologue of human LL-37. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon where it exhibits antimicrobial activity against enteric pathogens and it is established as a component of the innate antimicrobial defense in mice. mCRAMP deficiency has been linked to alcoholic liver disease (ALD) in mice and it also produces viral-induced responses in mouse cells. mCRAMP synergises wirh rifamycin for intracellular killing of mycobacteria.

Product Specifications

Purity

≥95%

Molecular Weight

3878.7

Notes

For research use only.

AA Sequence

GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nitric Oxide Synthase 1, Neuronal (NOS1) ELISA Kit
orb1662443-01 48 Tests

Mouse Nitric Oxide Synthase 1, Neuronal (NOS1) ELISA Kit

Sign In for Pricing
View Details
Mouse Nitric Oxide Synthase 1, Neuronal (NOS1) ELISA Kit
orb1662443-02 96 Tests

Mouse Nitric Oxide Synthase 1, Neuronal (NOS1) ELISA Kit

Sign In for Pricing
View Details
UPA Receptor Rabbit pAb
orb2709573-01 50 µL

UPA Receptor Rabbit pAb

Sign In for Pricing
View Details
UPA Receptor Rabbit pAb
orb2709573-02 100 µL

UPA Receptor Rabbit pAb

Sign In for Pricing
View Details
Anti-DCAF16 Antibody Picoband® Fluoro647 Conjugated
A15723-1-Fluoro647 100 µg/Vial

Anti-DCAF16 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Rat ENG; sCD105 (sENG; sCD105) ELISA Kit
YP-W35699-01 48 Tests

Rat ENG; sCD105 (sENG; sCD105) ELISA Kit

Sign In for Pricing
View Details