Defensin-1 (human) HNP-1
Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Defensin HNP-1 human exhibits broad antimicrobial and anti-leishmanial activities.
Product Specifications
Purity
≥95%
Molecular Weight
3442.1
Notes
For research use only.
AA Sequence
ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge:Cys2-Cys30, Cys4-Cys19, Cys9-Cys29)
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog