Defensin HNP-3 (human)
Defensin HNP-3 human is a cytotoxic antibiotic peptide known as "defensin". Defensin HNP-3 human has inhibitory activity against Staphylococcus aureus, Pseudomonas aeruginosa and Escherichia coli. Defensin HNP-3 human is initially synthesized as the 94 amino acids preproHNP (1-94), which is hydrolyzed to proHNP (20-94) and converted to mature HNP (65-94) after the removal of anion precursors.
Product Specifications
Field of Research
Infectious Disease & Virology
Purity
≥95%
Molecular Weight
3486.04
Notes
For research use only.
AA Sequence
DCYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge:Cys2-Cys30, Cys4-Cys19, Cys9-Cys29)
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog