Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement factor H (CFH), partial

This Recombinant Human Complement factor H (CFH), partial spans the amino acid sequence from region 19-449aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(H factor 1)

UniProt

P08603

Expression Region

19-449aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRHPR mouse monoclonal antibody
MB4235 25 ul

GRHPR mouse monoclonal antibody

Sign In for Pricing
View Details
Human RITA1 siRNA
abx904588-01 15 nmol

Human RITA1 siRNA

Sign In for Pricing
View Details
Human RITA1 siRNA
abx904588-02 30 nmol

Human RITA1 siRNA

Sign In for Pricing
View Details
Ccdc19 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7398106 1.0 µg DNA

Ccdc19 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Rabbit Monoclonal IL-4 Antibody (11B11) [DyLight 650]
NBP2-52656C 0.1 mL

Rabbit Monoclonal IL-4 Antibody (11B11) [DyLight 650]

Sign In for Pricing
View Details
Lentiviral mouse Col4a1 shRNA (UAS) - Lentiviral mouse Col4a1 shRNA (UAS, iRFP) (100)
GTR15176103 1 Vial

Lentiviral mouse Col4a1 shRNA (UAS) - Lentiviral mouse Col4a1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details