Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxiredoxin-1 (PRDX1)

This Recombinant Human Peroxiredoxin-1 (PRDX1) spans the amino acid sequence from region 1-199aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q06830

Expression Region

1-199aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD55 (DAF) (143-30), CF488A conjugate, 0.1mg/mL
BNC880179-100 1x 100 µL

CD55 (DAF) (143-30), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
pCMV-SPORT6-PRICKLE3 Plasmid
PVT13505 2 µg

pCMV-SPORT6-PRICKLE3 Plasmid

Sign In for Pricing
View Details
SNTA1 Rabbit Polyclonal Antibody
orb3069093-01 30 µL

SNTA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SNTA1 Rabbit Polyclonal Antibody
orb3069093-02 50 µL

SNTA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SNTA1 Rabbit Polyclonal Antibody
orb3069093-03 100 µL

SNTA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SNTA1 Rabbit Polyclonal Antibody
orb3069093-04 200 µL

SNTA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details