Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorocebus sabaeus Claudin (CLDN6) -VLPs (Active)

This Recombinant Chlorocebus sabaeus Claudin (CLDN6) -VLPs spans the amino acid sequence from region 22-220aa. Purity: The purity information is not available for VLPs proteins.

Product Specifications

UniProt

A0A0D9SBX5

Expression Region

22-220aa

Tag

C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)

Source

Mammalian cell

Origin

Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

The purity information is not available for VLPs proteins.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CLDN6 at 5 μg/mL can bind Anti-CLDN6/9 recombinant antibody. The EC50 is 4.186-6.635 ng/mL. The VLPs is negative control.

Form

Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

LVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSRGPSHYMARYSTSAPAISRGPSEYPTKNYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF594 conjugate, 0.1mg/mL
BNC940032-100 1x 100 µL

MUC2 (CCP58), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
BNC040276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL
BNC881073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
BNC400226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF640R conjugate, 0.1mg/mL
BNC400950-100 1x 100 µL

MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (K72.7), CF568 conjugate, 0.1mg/mL
BNC680757-500 1x 500 µL

Cytokeratin 7 (K72.7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details