Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Large ribosomal subunit protein bL12 (rplL)

This Recombinant Staphylococcus aureus Large ribosomal subunit protein bL12 (rplL) spans the amino acid sequence from region 1-122aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

A5IQ94

Expression Region

1-122aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain JH9)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVELTSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVELK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synaptotagmin X Rabbit Polyclonal Antibody (HRP)
orb482402 100 µL

Synaptotagmin X Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
LIPG rabbit polyclonal antibody, Aff - Purified
AP00307PU-N 100 µg

LIPG rabbit polyclonal antibody, Aff - Purified

Sign In for Pricing
View Details
Recombinant Human EpCAM/TROP1/CD326 (C-Fc)
AP76254-01 10 µg

Recombinant Human EpCAM/TROP1/CD326 (C-Fc)

Sign In for Pricing
View Details
Recombinant Human EpCAM/TROP1/CD326 (C-Fc)
AP76254-02 50 µg

Recombinant Human EpCAM/TROP1/CD326 (C-Fc)

Sign In for Pricing
View Details
Recombinant Human EpCAM/TROP1/CD326 (C-Fc)
AP76254-03 500 µg

Recombinant Human EpCAM/TROP1/CD326 (C-Fc)

Sign In for Pricing
View Details
Recombinant Human EpCAM/TROP1/CD326 (C-Fc)
AP76254-04 1 mg

Recombinant Human EpCAM/TROP1/CD326 (C-Fc)

Sign In for Pricing
View Details