Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 18 Minor capsid protein L2 (L2), partial

This Recombinant Human papillomavirus type 18 Minor capsid protein L2 (L2), partial spans the amino acid sequence from region 10-77aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

A9XFL2

Expression Region

10-77aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Human papillomavirus type 18

Field of Research

Infectious Disease & Virology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KRASVTDLYKTCKQSGTCPSDVVNKVEGTTLADKILQWSSLGIFLGGLGIGTGSGTGGRTGYIPLGGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F13A1 ELISA Kit (Human)
OKCD07135-96W 96 Well

F13A1 ELISA Kit (Human)

Sign In for Pricing
View Details
ABHD3 Polyclonal Antibody, PerCP Conjugated
bs-7947R-PerCP 100 µL

ABHD3 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
PFDN5 3'UTR Luciferase Stable Cell Line
TU017765 1.0 mL

PFDN5 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Bovine PPAR-β ELISA Kit
EBP0709 96 Tests

Bovine PPAR-β ELISA Kit

Sign In for Pricing
View Details
Zcchc8 Mouse Gene Knockout Kit (CRISPR)
KN519669 1 Kit

Zcchc8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor 145 (VEGF145) Antibody
abx129605-01 100 µL

Vascular Endothelial Growth Factor 145 (VEGF145) Antibody

Sign In for Pricing
View Details