Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-13 (IL13)

This Recombinant Human Interleukin-13 (IL13) spans the amino acid sequence from region 21-132aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Expression Region

21-132aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCAAT/Enhancer Binding Protein ε (CEBPε) Rat ELISA Kit
C2044 96 Tests

CCAAT/Enhancer Binding Protein ε (CEBPε) Rat ELISA Kit

Sign In for Pricing
View Details
Rbm7 (NM_144948) Mouse Tagged Lenti ORF Clone
MR203518L3 10 µg

Rbm7 (NM_144948) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit IL-1 alpha Polyclonal Antibody
PB0417U-01 20 µg

Rabbit IL-1 alpha Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit IL-1 alpha Polyclonal Antibody
PB0417U-02 100 µg

Rabbit IL-1 alpha Polyclonal Antibody

Sign In for Pricing
View Details
DBF4A Rabbit pAb, BF700 conjugated
orb2855949 100 µL

DBF4A Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
KCTD9 Rabbit Polyclonal Antibody (Biotin)
orb450580 100 µL

KCTD9 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details