Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-13 (IL13)

This Recombinant Human Interleukin-13 (IL13) spans the amino acid sequence from region 21-132aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Expression Region

21-132aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KLRC3 knockdown cell line
ABC-KD8030 1 Vial

Human KLRC3 knockdown cell line

Sign In for Pricing
View Details
C3 Antibody
GWB-22632B 10 mL

C3 Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Niemann-Pick type C2 Antibody (002) [Janelia Fluor 549]
NBP2-89467JF549 0.1 mL

Rabbit Monoclonal Niemann-Pick type C2 Antibody (002) [Janelia Fluor 549]

Sign In for Pricing
View Details
Rat Nephroblastoma Overexpressed Gene (NOV) Antibody Pair Kit (with Standard)
MBS2103543-01 5x 96 Tests

Rat Nephroblastoma Overexpressed Gene (NOV) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Nephroblastoma Overexpressed Gene (NOV) Antibody Pair Kit (with Standard)
MBS2103543-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Rat Nephroblastoma Overexpressed Gene (NOV) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Nephroblastoma Overexpressed Gene (NOV) Antibody Pair Kit (with Standard)
MBS2103543-03 10x 96 Tests

Rat Nephroblastoma Overexpressed Gene (NOV) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details