Recombinant Macaca fascicularis Macaca fascicularis brain cDNA clone: QorA-11660, similar to human lymphocyte antigen 6 complex, locus E (LY6E), mRNA, RefSeq: NM_002346.1
Selected Variant
GTR19066299-01
Size: 20 µg
This Recombinant Macaca fascicularis Macaca fascicularis brain cDNA clone: QorA-11660, similar to human lymphocyte antigen 6 complex, locus E (LY6E), mRNA, RefSeq: NM_002346.1 spans the amino acid sequence from region 21-131aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
UniProt
I7G3A4
Expression Region
21-131aa
Tag
C-terminal 6xHis-tagged
Source
E.coli
Origin
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Field of Research
Neuroscience; Immunology & Inflammation; Molecular Biology
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSTSAGIGNLVTFGHSLSKTCSPACPLPEGINVGVASMGISCCQSFLCNFSAADGGLRASATLLGAGLLLSLLPALLRFGP
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PA1235-carrier-free 100 µg/Vial
Anti-Protein SSX2 SSX2 Antibody Picoband®, Carrier-free
Sign In for Pricing
View Details 
PA1669-PE 100 µg/Vial
Anti-NF-kB p65/RELA Antibody Picoband®, PE Conjugate
Sign In for Pricing
View Details 
PA1234-Dylight488 100 µg
Anti-PKC gamma/PRKCG Antibody Picoband® (Dylight488 Conjugate)
Sign In for Pricing
View Details 
PA1317-1-HRP 100 µg/Vial
Anti-MTCO1/MT-CO1 Antibody Picoband®, HRP Conjugate
Sign In for Pricing
View Details 
BNC403588-100 1x 100 µL
CD95 / FAS / TNFRSF6 (FAS/3588), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details