Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth/differentiation factor 8 (MSTN) (Active)

This Recombinant Human Growth/differentiation factor 8 (MSTN) spans the amino acid sequence from region 24-375aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Growth/differentiation factor 8; GDF-8; Myostatin; MSTN; GDF8

UniProt

O14793

Expression Region

24-375aa

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human MSTN (GDF-8) at 2 μg/mL can bind Human ACVR2B. The EC50 is 68.26-74.59 ng/mL.

Form

Lyophilized powder

Molecular Weight

42.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tetrabromobisphenol S Dimethyl Ether-d6
467280 5 mg

Tetrabromobisphenol S Dimethyl Ether-d6

Sign In for Pricing
View Details
Human VTN protein
orb392712-01 10 µg

Human VTN protein

Sign In for Pricing
View Details
Human VTN protein
orb392712-02 50 µg

Human VTN protein

Sign In for Pricing
View Details
Human VTN protein
orb392712-03 500 µg

Human VTN protein

Sign In for Pricing
View Details
Pim-1 Oncogene (PIM1) Human ELISA Kit
F8934 96 Tests

Pim-1 Oncogene (PIM1) Human ELISA Kit

Sign In for Pricing
View Details
Human BSND Recombinant Protein
PROTQ8WZ55-50ug 50 µg

Human BSND Recombinant Protein

Sign In for Pricing
View Details