Recombinant Human Growth/differentiation factor 8 (MSTN) (Active)
This Recombinant Human Growth/differentiation factor 8 (MSTN) spans the amino acid sequence from region 24-375aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Growth/differentiation factor 8; GDF-8; Myostatin; MSTN; GDF8
UniProt
O14793
Expression Region
24-375aa
Tag
N-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Stem Cell & Developmental Biology
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human MSTN (GDF-8) at 2 μg/mL can bind Human ACVR2B. The EC50 is 68.26-74.59 ng/mL.
Form
Lyophilized powder
Molecular Weight
42.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A08427-2-Dylight488 100 µg
Anti-POLA2 Antibody Picoband® (Dylight488 Conjugate)
Sign In for Pricing
View Details