Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Monoglyceride lipase (Mgll)

This Recombinant Mouse Monoglyceride lipase (Mgll) spans the amino acid sequence from region 1-303aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MGL; Monoacylglycerol lipase (MAGL)

UniProt

O35678

Expression Region

1-303aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAGCPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPM2AIP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G9]
TA501927BM 100 µL

EPM2AIP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G9]

Sign In for Pricing
View Details
ABHD14B (NM_001146314) Human Over-expression Lysate
LY431791 100 µg

ABHD14B (NM_001146314) Human Over-expression Lysate

Sign In for Pricing
View Details
Human NUPR2 activation kit by CRISPRa
GA118057 1 Kit

Human NUPR2 activation kit by CRISPRa

Sign In for Pricing
View Details
2-Iodobenzonitrile
TRC-I689570-2.5G 2.5 g

2-Iodobenzonitrile

Sign In for Pricing
View Details
Hsp60 (HSPD1) Mouse Monoclonal Antibody [Clone ID: SPM253]
AM50115PU-T 20 µg

Hsp60 (HSPD1) Mouse Monoclonal Antibody [Clone ID: SPM253]

Sign In for Pricing
View Details
MyVolt™ Mini power supply, 230V
E2100-E 1 Each

MyVolt™ Mini power supply, 230V

Sign In for Pricing
View Details