Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ly6/PLAUR domain-containing protein 3 (LYPD3) (Active)

This Recombinant Human Ly6/PLAUR domain-containing protein 3 (LYPD3) spans the amino acid sequence from region 31-326aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ly6/PLAUR domain-containing protein 3; GPI-anchored metastasis-associated protein C4.4A homolog; Matrigel-induced gene C4 protein (MIG-C4) ; LYPD3; C4.4A; UNQ491/PRO1007

UniProt

O95274

Expression Region

31-326aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Human LYPD3 at 2 μg/mL can bind Anti-LYPD3 recombinant antibody. The EC50 is 2.375-2.905 ng/mL.

Form

Lyophilized powder

Molecular Weight

32.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Texas Red Conjugated Goat Polyclonal Antibody to Human a-2-Macroglobulin
TA-2117-2 2 mL

Texas Red Conjugated Goat Polyclonal Antibody to Human a-2-Macroglobulin

Sign In for Pricing
View Details
PP4R1 (PPP4R1) (NM_005134) Human Recombinant Protein
TP309255 20 µg

PP4R1 (PPP4R1) (NM_005134) Human Recombinant Protein

Sign In for Pricing
View Details
Human C6orf163 activation kit by CRISPRa
GA116469 1 Kit

Human C6orf163 activation kit by CRISPRa

Sign In for Pricing
View Details
7-Keto Cholesterol (~98%)
TRC-K185050-50MG 50 mg

7-Keto Cholesterol (~98%)

Sign In for Pricing
View Details
Cadherin 22 (CDH22) Rabbit Polyclonal Antibody
TA392812 100 µL

Cadherin 22 (CDH22) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF740 conjugate, 0.1mg/mL
BNC742406-100 1x 100 µL

Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details