Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ly6/PLAUR domain-containing protein 3 (LYPD3)

This Recombinant Human Ly6/PLAUR domain-containing protein 3 (LYPD3) spans the amino acid sequence from region 31-326aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GPI-anchored metastasis-associated protein C4.4A homolog (Matrigel-induced gene C4 protein) (MIG-C4)

UniProt

O95274

Expression Region

31-326aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Super Oxidase Dimutase (SOD) ELISA Kit
QY-E21411 96 Tests

Mouse Super Oxidase Dimutase (SOD) ELISA Kit

Sign In for Pricing
View Details
Tofacitinib Impurity 279
RM-T060608-01 10 mg

Tofacitinib Impurity 279

Sign In for Pricing
View Details
Tofacitinib Impurity 279
RM-T060608-02 25 mg

Tofacitinib Impurity 279

Sign In for Pricing
View Details
Tofacitinib Impurity 279
RM-T060608-03 50 mg

Tofacitinib Impurity 279

Sign In for Pricing
View Details
Tofacitinib Impurity 279
RM-T060608-04 100 mg

Tofacitinib Impurity 279

Sign In for Pricing
View Details
Bovine Microtubule associated protein 1 ELISA kit
GTR10372992 96 Well

Bovine Microtubule associated protein 1 ELISA kit

Sign In for Pricing
View Details