Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial (Active)

This Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial spans the amino acid sequence from region 234-362aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium-phosphate transport protein 2B; Na+; NaPi3b; Sodium/phosphate cotransporter 2B; Na+; NaPi-2b; Solute carrier family 34 member 2

UniProt

O95436

Expression Region

234-362aa

Tag

N-terminal 10xHis-tagged and C-terminal mFc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human SLC34A2 at 2 μg/mL can bind Anti-SLC34A2 recombinant antibody. The EC50 is 32.86-37.66 ng/mL.

Form

Lyophilized powder

Molecular Weight

45.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P15RS Polyclonal Antibody
bs-6391R 100 µL

P15RS Polyclonal Antibody

Sign In for Pricing
View Details
Glutathione Peroxidase 3/GPx-3 Rabbit Monoclonal Antibody
E56G3479 100 µL

Glutathione Peroxidase 3/GPx-3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Lipophilin B Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-6546R-BF350 100 µL

Lipophilin B Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal ARG2 Antibody (7F8) [Janelia Fluor 646]
NBP2-59406JF646 0.1 mL

Mouse Monoclonal ARG2 Antibody (7F8) [Janelia Fluor 646]

Sign In for Pricing
View Details
Phospho-Erk1 (T202/Y204) + Erk2 (T185/Y187) Rabbit Monoclonal Antibody
E46F1796 40 µL

Phospho-Erk1 (T202/Y204) + Erk2 (T185/Y187) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Ghrelin Receptor/GHSR Antibody (502430) [Janelia Fluor 525]
FAB8370JF525 0.1 mL

Mouse Monoclonal Ghrelin Receptor/GHSR Antibody (502430) [Janelia Fluor 525]

Sign In for Pricing
View Details