Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Macrophage colony-stimulating factor 1 (Csf1), partial

This Recombinant Mouse Macrophage colony-stimulating factor 1 (Csf1), partial spans the amino acid sequence from region 33-262aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CSF-1; MCSF; Proteoglycan macrophage colony-stimulating factor

UniProt

P07141

Expression Region

33-262aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cystatin-F (CST7) Mouse ELISA Kit
C7234 96 Tests

Cystatin-F (CST7) Mouse ELISA Kit

Sign In for Pricing
View Details
2- (Piperazin-1-Yl) Ethanamine
RG-P091616-01 10 mg

2- (Piperazin-1-Yl) Ethanamine

Sign In for Pricing
View Details
2- (Piperazin-1-Yl) Ethanamine
RG-P091616-02 25 mg

2- (Piperazin-1-Yl) Ethanamine

Sign In for Pricing
View Details
2- (Piperazin-1-Yl) Ethanamine
RG-P091616-03 50 mg

2- (Piperazin-1-Yl) Ethanamine

Sign In for Pricing
View Details
2- (Piperazin-1-Yl) Ethanamine
RG-P091616-04 100 mg

2- (Piperazin-1-Yl) Ethanamine

Sign In for Pricing
View Details
OSCAR protein (His tag)
80R-2834 0.1 mg

OSCAR protein (His tag)

Sign In for Pricing
View Details