Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Insulin-like growth factor I (IGF1)

This Recombinant Bovine Insulin-like growth factor I (IGF1) spans the amino acid sequence from region 50-119aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IGF-I; Somatomedin

UniProt

P07455

Expression Region

50-119aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cullin 3 (CUL3) Rabbit Polyclonal Antibody
AP07573SU-N 50 µL

Cullin 3 (CUL3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Gpat3 Mouse Gene Knockout Kit (CRISPR)
KN500991 1 Kit

Gpat3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD56 (NCAM1) Mouse Monoclonal Antibody [Clone ID: 123C3]
AM05639PU-L 200 µg

CD56 (NCAM1) Mouse Monoclonal Antibody [Clone ID: 123C3]

Sign In for Pricing
View Details
Human AGR2 (Anterior Gradient Protein 2) CLIA Kit
E-CL-H0243-01 24 Tests

Human AGR2 (Anterior Gradient Protein 2) CLIA Kit

Sign In for Pricing
View Details
Human AGR2 (Anterior Gradient Protein 2) CLIA Kit
E-CL-H0243-02 48 Tests

Human AGR2 (Anterior Gradient Protein 2) CLIA Kit

Sign In for Pricing
View Details
Human AGR2 (Anterior Gradient Protein 2) CLIA Kit
E-CL-H0243-03 96 Tests

Human AGR2 (Anterior Gradient Protein 2) CLIA Kit

Sign In for Pricing
View Details