Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-3 (IL3) (Active)

This Recombinant Human Interleukin-3 (IL3) spans the amino acid sequence from region 20-152aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-3; Hematopoietic growth factor; Mast cell growth factor; MCGF; Multipotential colony-stimulating factor; P-cell-stimulating factor

UniProt

P08700

Expression Region

20-152aa

Tag

C-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 0.4476-1.272 ng/mL.

Form

Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UMPS (NM_000373) Human Tagged ORF Clone Lentiviral Particle
RC201324L1V 200 µL

UMPS (NM_000373) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MARCHF9 Human siRNA Oligo Duplex (Locus ID 92979)
SR314235 1 Kit

MARCHF9 Human siRNA Oligo Duplex (Locus ID 92979)

Sign In for Pricing
View Details
Gα 11 (D-6) Alexa Fluor® 680
sc-390382 AF680 200 µg/mL

Gα 11 (D-6) Alexa Fluor® 680

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Killer Cell Immunoglobulin Like Receptor 2DL1 (KIR2DL1)
MBS2133239-01 0.1 mL

Cy3 Linked Monoclonal Antibody to Killer Cell Immunoglobulin Like Receptor 2DL1 (KIR2DL1)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Killer Cell Immunoglobulin Like Receptor 2DL1 (KIR2DL1)
MBS2133239-02 0.2 mL

Cy3 Linked Monoclonal Antibody to Killer Cell Immunoglobulin Like Receptor 2DL1 (KIR2DL1)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Killer Cell Immunoglobulin Like Receptor 2DL1 (KIR2DL1)
MBS2133239-03 0.5 mL

Cy3 Linked Monoclonal Antibody to Killer Cell Immunoglobulin Like Receptor 2DL1 (KIR2DL1)

Sign In for Pricing
View Details