Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glutamine synthetase (GLUL)

This Recombinant Human Glutamine synthetase (GLUL) spans the amino acid sequence from region 2-373aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GS; Glutamate--ammonia ligase; Palmitoyltransferase GLUL

UniProt

P15104

Expression Region

2-373aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shewanella sp. ATP synthase subunit b (atpF), partial
MBS7054038 Inquire

Recombinant Shewanella sp. ATP synthase subunit b (atpF), partial

Sign In for Pricing
View Details
ZG16B (LOC124220, Zymogen Granule Protein 16 Homolog B, UNQ773/PRO1567) (MaxLight 550)
129155-ML550 100 µL

ZG16B (LOC124220, Zymogen Granule Protein 16 Homolog B, UNQ773/PRO1567) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Human ADAM22 Protein
E30PQ770 20 µg

Recombinant Human ADAM22 Protein

Sign In for Pricing
View Details
Rabbit Monoclonal c-Myc Antibody (MYC/7682R) [Alexa Fluor 405]
NBP3-20787AF405 0.1 mL

Rabbit Monoclonal c-Myc Antibody (MYC/7682R) [Alexa Fluor 405]

Sign In for Pricing
View Details
Gel Loading Pipette Tips
GLPT-1 200 Pieces

Gel Loading Pipette Tips

Sign In for Pricing
View Details
TMC2 Protein Vector (Mouse) (pPM-C-His)
PV238761 500 ng

TMC2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details