Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kallikrein-2 (KLK2)

This Recombinant Human Kallikrein-2 (KLK2) spans the amino acid sequence from region 25-261aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glandular kallikrein-1; hGK-1; Tissue kallikrein-2

UniProt

P20151

Expression Region

25-261aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS716810 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
ATP6V0A1 Rabbit Polyclonal Antibody
TA366065 100 µL

ATP6V0A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ku-Holo (p70;83) (KU729), CF568 conjugate, 0.1mg/mL
BNC680729-100 1x 100 µL

Ku-Holo (p70;83) (KU729), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAD67 Recombinant Rabbit Monoclonal Antibody [JM11-11]
ET1703-71 100 µL

GAD67 Recombinant Rabbit Monoclonal Antibody [JM11-11]

Sign In for Pricing
View Details
Dysferlin (DYSF) (NM_001130987) Human Recombinant Protein
TP326456 20 µg

Dysferlin (DYSF) (NM_001130987) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant SEC24D Antibody
RC-5912-01 50 μL

Recombinant SEC24D Antibody

Sign In for Pricing
View Details