Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial

This Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial spans the amino acid sequence from region 26-232aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-4 receptor subunit alpha; IL-4R subunit alpha; IL-4R-alpha; IL-4RA; CD antigen CD124; Soluble IL-4 receptor subunit alpha; Soluble IL-4R-alpha; sIL4Ralpha/prot; IL-4-binding protein; IL4-BP

UniProt

P24394

Expression Region

26-232aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
26028066 1.0 µg DNA

KRT4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
NPHS1 CRISPR Knock Out 293T Cell Line (Human)
32060141 1x 10^6 Cells / 1.0 mL

NPHS1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
1- (5-Bromo-7-methyl-1-benzofuran-2-yl) -2-methylpropan-1-one
HHC68176-01 50 mg

1- (5-Bromo-7-methyl-1-benzofuran-2-yl) -2-methylpropan-1-one

Sign In for Pricing
View Details
1- (5-Bromo-7-methyl-1-benzofuran-2-yl) -2-methylpropan-1-one
HHC68176-02 0.5 g

1- (5-Bromo-7-methyl-1-benzofuran-2-yl) -2-methylpropan-1-one

Sign In for Pricing
View Details
RSA-14-44 AAV siRNA Pooled Vector
42764166 1.0 µg

RSA-14-44 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Arrestin-C (m) -PR
sc-61997-PR 10 µM - 20 µL

Arrestin-C (m) -PR

Sign In for Pricing
View Details