Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-13 (IL13)

This Recombinant Human Interleukin-13 (IL13) spans the amino acid sequence from region 25-146aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P35225

Expression Region

25-146aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tenascin C (TNC) (NM_002160) Human Recombinant Protein
TP315251M 100 µg

Tenascin C (TNC) (NM_002160) Human Recombinant Protein

Sign In for Pricing
View Details
2-(2-Amino-5-bromobenzoyl)pyridine
TRC-A601785-50MG 50 mg

2-(2-Amino-5-bromobenzoyl)pyridine

Sign In for Pricing
View Details
L-Phenylalanine-¹³C₉ (9CI)
TRC-P335557-1MG 1 mg

L-Phenylalanine-¹³C₉ (9CI)

Sign In for Pricing
View Details
Human CYRIA activation kit by CRISPRa
GA113060 1 Kit

Human CYRIA activation kit by CRISPRa

Sign In for Pricing
View Details
Human YY1 associated factor 2 (YAF2) activation kit by CRISPRa
GA106881 1 Kit

Human YY1 associated factor 2 (YAF2) activation kit by CRISPRa

Sign In for Pricing
View Details
Ptprn2 Mouse Gene Knockout Kit (CRISPR)
KN514236 1 Kit

Ptprn2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details