Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-13 (IL13)

This Recombinant Human Interleukin-13 (IL13) spans the amino acid sequence from region 25-146aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P35225

Expression Region

25-146aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NMDAR1 (GRIN1) (NM_007327) Human Recombinant Protein
TP316458L 1 mg

NMDAR1 (GRIN1) (NM_007327) Human Recombinant Protein

Sign In for Pricing
View Details
OSR1 (Ab-185) Antibody
8B8154-AAT 50 µg

OSR1 (Ab-185) Antibody

Sign In for Pricing
View Details
Protein C (PROC) (NM_000312) Human Over-expression Lysate
LY400117 100 µg

Protein C (PROC) (NM_000312) Human Over-expression Lysate

Sign In for Pricing
View Details
TRITC Conjugated Maclura pomifera Lectin (Osage Orange) -MPA-
R-3901-1 2 mg

TRITC Conjugated Maclura pomifera Lectin (Osage Orange) -MPA-

Sign In for Pricing
View Details
Hole-type OR lamp BOPL-203
BOPL-203 1 Unit

Hole-type OR lamp BOPL-203

Sign In for Pricing
View Details
GRASP65 (GORASP1) Rabbit Polyclonal Antibody
TA376684 100 µL

GRASP65 (GORASP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details