Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-13 (IL13)

This Recombinant Human Interleukin-13 (IL13) spans the amino acid sequence from region 25-146aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P35225

Expression Region

25-146aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMS2/PMS2CL Antibody
8C18035-AAT 50 µg

PMS2/PMS2CL Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS626290 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF594 conjugate, 0.1mg/mL
BNC942460-100 1x 100 µL

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-DRB (MHC II) (DA2), CF568 conjugate, 0.1mg/mL
BNC682281-500 1x 500 µL

HLA-DRB (MHC II) (DA2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Fzd1 activation kit by CRISPRa
GA201493 1 Kit

Mouse Fzd1 activation kit by CRISPRa

Sign In for Pricing
View Details
Glypican-3 (GPC3/863 + 1G12), CF405S conjugate, 0.1mg/mL
BNC040864-500 1x 500 µL

Glypican-3 (GPC3/863 + 1G12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details