Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gastric inhibitory polypeptide (Gip), partial

This Recombinant Mouse Gastric inhibitory polypeptide (Gip), partial spans the amino acid sequence from region 44-85aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GIP; Glucose-dependent insulinotropic polypeptide

UniProt

P48756

Expression Region

44-85aa

Tag

N-terminal hFc-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Gastroenterology & Hepatology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YAEGTFISDYSIAMDKIRQQDFVNWLLAQRGKKSDWKHNITQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Scheffersomyces stipitis Ribosome-releasing factor 2, mitochondrial (MEF2), partial
MBS1166089 Inquire

Recombinant Scheffersomyces stipitis Ribosome-releasing factor 2, mitochondrial (MEF2), partial

Sign In for Pricing
View Details
APIP protein (His tag)
80R-2353 0.1 mg

APIP protein (His tag)

Sign In for Pricing
View Details
Car2 3'UTR GFP Stable Cell Line
TU153124 1.0 mL

Car2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Prm3 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3982503 1.0 µg DNA

Prm3 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
GPX1 Rabbit Monoclonal Antibody [KD Validation]
E51K4275 40 µL

GPX1 Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
RHOH Protein Vector (Rat) (pPM-C-HA)
PV301408 500 ng

RHOH Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details