Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Lactadherin (MFGE8)

This Recombinant Pig Lactadherin (MFGE8) spans the amino acid sequence from region 1-409aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MFGM; Milk fat globule-EGF factor 8; MFG-E8; SED1; Sperm surface protein SP47; PP47

UniProt

P79385

Expression Region

1-409aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Cardiovascular Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FSGDFCDSSLCLNGGTCLLDQDPQKPFHCLCPEGFTGLICNETEKGPCFPNPCHNDAECEVIDDAHRGDVFTEYICKCPHGYTGIHCEIICNAPLGMETGAIADFQISASSMHLGFMGLQRWAPELARLHRAGIVNAWTASNYDRNPWIQVNLLRRMRVTGVVTQGASRAGSAEYMKTFKVAYSTDGRKFQFIQGAEESGDKIFMGNLDNSGLKVNLFEVPLEVQYVRLVPIICHRGCTLRFELLGCELSGCAEPLGLKDNTIPNKQITASSFYRTWGLSAFSWYPFYARLDNQGKFNAWTAQSNSASEWLQIDLGSQRRVTGIITQGARDFGHIQYVAAYKVAYSDDGVSWTEYRDQGALEGKIFPGNLDNNSHKKNMFETPFLTRFVRILPVAWHNRITLRVELLGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bspry Rat shRNA Plasmid (Locus ID 64027)
TR710636 1 Kit

Bspry Rat shRNA Plasmid (Locus ID 64027)

Sign In for Pricing
View Details
Z-D-Asparagine extrapure, 99%
92873-01 1 g

Z-D-Asparagine extrapure, 99%

Sign In for Pricing
View Details
Z-D-Asparagine extrapure, 99%
92873-02 5 g

Z-D-Asparagine extrapure, 99%

Sign In for Pricing
View Details
Z-D-Asparagine extrapure, 99%
92873-03 25 g

Z-D-Asparagine extrapure, 99%

Sign In for Pricing
View Details
PODXL2 Protein, Human, Recombinant (C-His)
E51P01981 100 µg

PODXL2 Protein, Human, Recombinant (C-His)

Sign In for Pricing
View Details
3-Bromo-1- (triisopropylsilyl) indole
sc-260723 1 g

3-Bromo-1- (triisopropylsilyl) indole

Sign In for Pricing
View Details