Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Cytolethal distending toxin subunit A (cdtA)

This Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Cytolethal distending toxin subunit A (cdtA) spans the amino acid sequence from region 20-268aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CDT A

UniProt

Q0PC56

Expression Region

20-268aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

Field of Research

Infectious Disease & Virology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSSKFENVNPLGRSFGEFEDTDPLKLGLEPTFPTNQEIPSLISGADLVPITPITPPLTRTSNSANNNAANGINPRFKDEAFNDVLIFENRPAVSDFLTILGPSGAALTVWALAQGNWIWGYTLIDSKGFGDARVWQLLLYPNDFAMIKNAKTNTCLNAYGNGIVHYPCDASNHAQMWKLIPMSNTAVQIKNLGNGKCIQAPITNLYGDFHKVFKIFTVECAKKDNFDQQWFLTTPPFTAKPLYRQGEVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigeon Beta-Thromboglobulin ELISA Kit
MBS069900 Inquire

Pigeon Beta-Thromboglobulin ELISA Kit

Sign In for Pricing
View Details
Rat Extracellular Signal Regulated Kinase ELISA kit
GTR10437409 96 Well

Rat Extracellular Signal Regulated Kinase ELISA kit

Sign In for Pricing
View Details
BEND5 Double Nickase Plasmid (m2)
sc-426658-NIC-2 20 µg

BEND5 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Rabbit Sterol regulatory element-binding protein 1 (SREBF1) ELISA Kit
MBS2612731-01 48 Well

Rabbit Sterol regulatory element-binding protein 1 (SREBF1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Sterol regulatory element-binding protein 1 (SREBF1) ELISA Kit
MBS2612731-02 96 Well

Rabbit Sterol regulatory element-binding protein 1 (SREBF1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Sterol regulatory element-binding protein 1 (SREBF1) ELISA Kit
MBS2612731-03 5x 96 Well

Rabbit Sterol regulatory element-binding protein 1 (SREBF1) ELISA Kit

Sign In for Pricing
View Details