Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Cytolethal distending toxin subunit A (cdtA)

This Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Cytolethal distending toxin subunit A (cdtA) spans the amino acid sequence from region 20-268aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CDT A

UniProt

Q0PC56

Expression Region

20-268aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

Field of Research

Infectious Disease & Virology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSSKFENVNPLGRSFGEFEDTDPLKLGLEPTFPTNQEIPSLISGADLVPITPITPPLTRTSNSANNNAANGINPRFKDEAFNDVLIFENRPAVSDFLTILGPSGAALTVWALAQGNWIWGYTLIDSKGFGDARVWQLLLYPNDFAMIKNAKTNTCLNAYGNGIVHYPCDASNHAQMWKLIPMSNTAVQIKNLGNGKCIQAPITNLYGDFHKVFKIFTVECAKKDNFDQQWFLTTPPFTAKPLYRQGEVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nav beta 3 Antibody, Clone N396/29: APC
SMC-490D-APC 100 µg

Nav beta 3 Antibody, Clone N396/29: APC

Sign In for Pricing
View Details
ELAVL1 Antibody, Biotin conjugated
CSB-PA618993HD01HU-01 50 µg

ELAVL1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
ELAVL1 Antibody, Biotin conjugated
CSB-PA618993HD01HU-02 100 µg

ELAVL1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
PWWP Domain-Containing Protein MUM1 (MUM1) Antibody
abx029726-01 80 µL

PWWP Domain-Containing Protein MUM1 (MUM1) Antibody

Sign In for Pricing
View Details
PWWP Domain-Containing Protein MUM1 (MUM1) Antibody
abx029726-02 400 µL

PWWP Domain-Containing Protein MUM1 (MUM1) Antibody

Sign In for Pricing
View Details
P4HA2 (NM_001017974) Human Untagged Clone
SC302099 10 µg

P4HA2 (NM_001017974) Human Untagged Clone

Sign In for Pricing
View Details