Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human/Cynomolgus monkey Activin receptor type-2B (ACVR2B), partial (Active)

This Recombinant Human Activin receptor type-2B (ACVR2B), Partial spans the amino acid sequence from region 19-137aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activin receptor type-2B; EC:2.7.11.30; Activin receptor type IIB (ACTR-IIB) ; ACVR2B

UniProt

Q13705, A0A2K5WUB0

Expression Region

19-137aa

Tag

C-terminal hFc1-Flag-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE. Greater than 95% as determined by SEC-HPLC.

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Human INHBA at 2 μg/mL can bind Human ACVR2B. The EC50 is 45.93-52.42 ng/mL.

Form

Lyophilized powder

Molecular Weight

43.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM174B (NM_207446) Human Over-expression Lysate
LC404039 20 µg

FAM174B (NM_207446) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Kappa Light Chain (L1C1), CF740 conjugate, 0.1mg/mL
BNC740018-100 1x 100 µL

Human Kappa Light Chain (L1C1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
rac-Propanolol
TRC-P840013-50MG 50 mg

rac-Propanolol

Sign In for Pricing
View Details
DUSP28 (NM_001033575) Human Recombinant Protein
TP306912 20 µg

DUSP28 (NM_001033575) Human Recombinant Protein

Sign In for Pricing
View Details
CDH2 Antibody
8C12100-AAT 50 µg

CDH2 Antibody

Sign In for Pricing
View Details
Human MMP3, C-His, Flag Tag
HA210853-01 20 µg

Human MMP3, C-His, Flag Tag

Sign In for Pricing
View Details