Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 1-acyl-sn-glycerol-3-phosphate acyltransferase beta (Agpat2) -Detergent

This Recombinant Mouse 1-acyl-sn-glycerol-3-phosphate acyltransferase beta (Agpat2) -Detergent spans the amino acid sequence from region 24-278aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

1-acylglycerol-3-phosphate O-acyltransferase 2;1-AGP acyltransferase 2;1-AGPAT 2; Lysophosphatidic acid acyltransferase beta; LPAAT-beta

UniProt

Q8K3K7

Expression Region

24-278aa

Tag

N-terminal 10xHis-tagged and C-terminal Twin-Strep-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid

Molecular Weight

32.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

50 mM HEPES, 0.15 M NaCl, 0.05% DDM, 0.01% CHS, pH 7.5

AA Sequence

ARFYAKVGLYCVLCLSFSAAASIVCLLRHGGRTVDNMSIISWFVRSFKYVYGLRFEVSGQKKLEVDGPCVIISNHQSILDMMGLMEILPKRCVQIAKRELMFTGPVGLIMYLGGVYFINRQQARTAMSVMADLGDLMVKENLKVWIYPEGTRNDNGDLLPFKKGAFYLAIQAQVPIIPVVYSSFSSFYNVKTKLFTSGTIKVQVLDAVPTNGLTDADVTKLVDTCYQSMRATFLQISQIPQENSAIKEPGVLPAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL
BNC470043-100 1x 100 µL

P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL
BNC400978-500 1x 500 µL

CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF647 conjugate, 0.1mg/mL
BNC470851-500 1x 500 µL

HSP60 (LK1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (DCS-60.2), CF740 conjugate, 0.1mg/mL
BNC740822-100 1x 100 µL

P21 / WAF1 (DCS-60.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD62L (L-Selectin) (LAM1-116), CF488A conjugate, 0.1mg/mL
BNC881587-100 1x 100 µL

CD62L (L-Selectin) (LAM1-116), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF647 conjugate, 0.1mg/mL
BNC471099-100 1x 100 µL

CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details