Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse General transcription factor II-I (Gtf2i), partial

This Recombinant Mouse General transcription factor II-I (Gtf2i), partial spans the amino acid sequence from region 730-820aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GTFII-I; TFII-I; Bruton tyrosine kinase-associated protein 135; BAP-135; BTK-associated protein 135

UniProt

Q9ESZ8

Expression Region

730-820aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ITDLKQKVENLFNEKCGEALGLKQAVKVPFALFESFPEDFYVEGLPEGVPFRRPSTFGIPRLEKILRNKAKIKFIIKKPEMFETAIKESTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNase A ≥100U/mg *opti, 1g
1387-1g-01 250 mg

RNase A ≥100U/mg *opti, 1g

Sign In for Pricing
View Details
RNase A ≥100U/mg *opti, 1g
1387-1g-02 1 g

RNase A ≥100U/mg *opti, 1g

Sign In for Pricing
View Details
Genesig® Complete kit for C.psittaci-v2.0
R01111 150 Tests

Genesig® Complete kit for C.psittaci-v2.0

Sign In for Pricing
View Details
Human Kisspeptin 1 (KISS1) ELISA Kit
RD-KISS1-Hu-96Tests 96 Tests

Human Kisspeptin 1 (KISS1) ELISA Kit

Sign In for Pricing
View Details
ARID3B (C-6) Alexa Fluor® 680
sc-514741 AF680 200 µg/mL

ARID3B (C-6) Alexa Fluor® 680

Sign In for Pricing
View Details
CABLES2 Rabbit Polyclonal Antibody (BF750)
orb2409070 100 µL

CABLES2 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details