Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant BK polyomavirus Small t antigen, Biotinylated

This Recombinant BK polyomavirus Small t antigen, Biotinylated spans the amino acid sequence from region 1-172aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ST; ST-AG

UniProt

P15000

Expression Region

1-172aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

BK polyomavirus (strain AS) (BKPyV)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDKVLNREESMELMDLLGLERAAWGNLPLMRKAYLKKCKEFHPDKGGDEDKMKRMNTLYKKMEQDVKVAHQPDFGTWNSSEVCADFPLCPDTLYCKEWPICSKKPSVHCPCMLCQLRLRHLNRKFLRKEPLVWIDCYCIDCFTQWFGLDLTEETLQWWVQIIGETPFRDLKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant LRRC15 Antibody
RC-5078-01 50 μL

Recombinant LRRC15 Antibody

Sign In for Pricing
View Details
Recombinant LRRC15 Antibody
RC-5078-02 100 µL

Recombinant LRRC15 Antibody

Sign In for Pricing
View Details
Recombinant LRRC15 Antibody
RC-5078-03 1 mL

Recombinant LRRC15 Antibody

Sign In for Pricing
View Details
SOX9 Recombinant Rabbit monoclonal Antibody
HA750262 100 µL

SOX9 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CDX2 (GI Epithelial Marker) (CDX2/2951R), CF405S conjugate, 0.1mg/mL
BNC042951-100 1x 100 µL

CDX2 (GI Epithelial Marker) (CDX2/2951R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Trisodium Isocitric Acid
TRC-T886250-1G 1 g

Trisodium Isocitric Acid

Sign In for Pricing
View Details